PlantTFDB
Plant Transcription Factor Database
v4.0
Previous version: v3.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID HL.SW.v1.0.G026316.1
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; rosids; fabids; Rosales; Cannabaceae; Humulus
Family Dof
Protein Properties Length: 366aa    MW: 38908.6 Da    PI: 8.1021
Description Dof family protein
Gene Model
Gene Model ID Type Source Coding Sequence
HL.SW.v1.0.G026316.1genomeHOPBASEView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1zf-Dof123.75.9e-392784562
                zf-Dof  5 alkcprCdstntkfCyynnyslsqPryfCkaCrryWtkGGalrnvPvGggrrknkkss 62
                          alkcprCds+ntkfCyynnyslsqPr+fCkaC+ryWt+GG+lrnvPvGgg+rknk+++
  HL.SW.v1.0.G026316.1 27 ALKCPRCDSSNTKFCYYNNYSLSQPRHFCKACKRYWTRGGTLRNVPVGGGCRKNKRVK 84
                          689****************************************************976 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
ProDomPD0074781.0E-272782IPR003851Zinc finger, Dof-type
PfamPF027011.0E-332882IPR003851Zinc finger, Dof-type
PROSITE profilePS5088429.5252882IPR003851Zinc finger, Dof-type
PROSITE patternPS0136103066IPR003851Zinc finger, Dof-type
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0006355Biological Processregulation of transcription, DNA-templated
GO:0003677Molecular FunctionDNA binding
Sequence ? help Back to Top
Protein Sequence    Length: 366 aa     Download sequence    Send to blast
MASSDHHGRP TMEKQSQEQL QQQQGLALKC PRCDSSNTKF CYYNNYSLSQ PRHFCKACKR  60
YWTRGGTLRN VPVGGGCRKN KRVKRPSSGT ANSDGSGANS SSSSANNNSH PGSLLGQPHQ  120
IDLSSTSHMI SPLFYGLPGN PSSDMSHVLP FSRFMNSTAS GYDLHDQPQL INALGLGFSS  180
SSAAAGNIND SDHHYQNGFS STTTPKYIQD IVSSNSLFST YNSLFSASTP LSSATGASPT  240
IASLFASKFA NGGLKDSRGP MNHFHQPLTV PFEDLHIGNA AAANGGGGED LNLSTKQAVK  300
LEDHGQRRFD WSSSAAAAAD CQNQTEQIGL SPSDPSLYWN PTVAVGTNWH DPTNSSIGSS  360
VPSLI*
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieve-
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_015890946.11e-101PREDICTED: dof zinc finger protein DOF1.4-like
TrEMBLA0A067GDE28e-99A0A067GDE2_CITSI; Uncharacterized protein
STRINGPOPTR_0011s05450.11e-84(Populus trichocarpa)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
FabidsOGEF45223356
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT1G28310.19e-37Dof family protein